- Recombinant Bacillus subtilis UPF0699 transmembrane protein ydbS (ydbS)
- MyBioSource.com
- Pricing InfoSupplier PageView Company Product Page
- MBS1091218
- 1 mg (E Coli Derived)
- This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications
- >90%
- Recombinant Protein
- 18,122 Da
- E Coli or Yeast
- 1-159
- UPF0699 transmembrane protein ydbS (ydbS)
Sequence
MREQPKNQISPDGLKVWRLQEIIISAVCLLIVIAVAVLSYYFHWPYWISGVLGAVWLLGSIVTVFIIPKVRHKVWRYEVHEHEIDIQSGIFVVTRVIVPMVRVQHVDTSQGPLLKKYNLATVKISTAATVHSIPALEMEEADRLRDSISRLARVTDDDV